SCOP 1.75: Domain d1lvoa_: 1lvo A:

Lineage for d1lvoa_ (1lvo A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
   contains an extra alpha-helical domain

7. Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)

8. Domain d1lvoa_: 1lvo A: [74284]

Details for d1lvoa_

PDB Entry: 1lvo, 1.96 Å

PDB Description: structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain

PDB Compounds: (A:) Replicase, hydrolase domain

SCOP Domain Sequences for d1lvoa_:

Sequence; same for both SEQRES and ATOM records:

>d1lvoa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

Timeline for d1lvoa_:

• d1lvoa_ first appeared in SCOP 1.61
  
• d1lvoa_ appears in SCOP 1.73
  
• d1lvoa_ appears in SCOPe 2.01
  
• d1lvoa_ appears in the current release, SCOPe 2.08