Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species) contains an extra alpha-helical domain |
Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries) |
Domain d1lvoe_: 1lvo E: [74288] |
PDB Entry: 1lvo (more details), 1.96 Å
SCOP Domain Sequences for d1lvoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvoe_ b.47.1.4 (E:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]} sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv
Timeline for d1lvoe_: