Lineage for d1lvoa_ (1lvo A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 168747Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 168765Protein Coronavirus main proteinase [74979] (1 species)
  7. 168766Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (1 PDB entry)
  8. 168767Domain d1lvoa_: 1lvo A: [74284]

Details for d1lvoa_

PDB Entry: 1lvo (more details), 1.96 Å

PDB Description: structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain

SCOP Domain Sequences for d1lvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvoa_ b.47.1.4 (A:) Coronavirus main proteinase {Transmissible gastroenteritis virus}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

SCOP Domain Coordinates for d1lvoa_:

Click to download the PDB-style file with coordinates for d1lvoa_.
(The format of our PDB-style files is described here.)

Timeline for d1lvoa_: