Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains automatically mapped to Pfam PF01413 |
Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75587] (5 PDB entries) |
Domain d1li1c1: 1li1 C:5-114 [73902] alpha 1 (chains A,B,D and E) and alpha 2 (chains C and F) isoforms complexed with act |
PDB Entry: 1li1 (more details), 1.9 Å
SCOPe Domain Sequences for d1li1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1li1c1 d.169.1.6 (C:5-114) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]} gyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpfly cnpgdvcyyasrndksywlsttaplpmmpvaedeikpyisrcsvceap
Timeline for d1li1c1: