Class a: All alpha proteins [46456] (171 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) contains a small beta-sheet (wing) |
Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (1 protein) |
Protein Anaphase promoting complex (APC) [74680] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [74682] (2 PDB entries) |
Domain d1ldkb1: 1ldk B:687-776 [73852] Other proteins in same PDB: d1ldka_, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1 complexed with zn |
PDB Entry: 1ldk (more details), 3.1 Å
SCOP Domain Sequences for d1ldkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldkb1 a.4.5.34 (B:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens)} pmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprv pvikkcidiliekeylervdgekdtysyla
Timeline for d1ldkb1: