SCOP 1.63: Domain d1ldkb1: 1ldk B:687-776

Lineage for d1ldkb1 (1ldk B:687-776)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (1 protein)

6. Protein Anaphase promoting complex (APC) [74680] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74682] (2 PDB entries)

8. Domain d1ldkb1: 1ldk B:687-776 [73852]
   Other proteins in same PDB: d1ldka_, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1
   complexed with zn

Details for d1ldkb1

PDB Entry: 1ldk, 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldkb1:

Sequence; same for both SEQRES and ATOM records:

>d1ldkb1 a.4.5.34 (B:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens)}
pmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprv
pvikkcidiliekeylervdgekdtysyla

Timeline for d1ldkb1:

• d1ldkb1 first appeared in SCOP 1.61
  
• d1ldkb1 appears in SCOP 1.65
  
• d1ldkb1 appears in the current release, SCOPe 2.08