Lineage for d1ldkb2 (1ldk B:411-686)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267422Fold e.40: Culin homology domain [75631] (1 superfamily)
    3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like
  4. 267423Superfamily e.40.1: Culin homology domain [75632] (1 family) (S)
  5. 267424Family e.40.1.1: Culin homology domain [75633] (1 protein)
  6. 267425Protein Culin homolog 1, cul-1 [75634] (1 species)
  7. 267426Species Human (Homo sapiens) [TaxId:9606] [75635] (2 PDB entries)
  8. 267428Domain d1ldkb2: 1ldk B:411-686 [73853]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1
    complexed with zn

Details for d1ldkb2

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkb2 e.40.1.1 (B:411-686) Culin homolog 1, cul-1 {Human (Homo sapiens)}
maqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakml
akrlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsep
ldldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgel
vtncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllv
ledenanvdevelkpdtliklylgyknkklrvninv

SCOP Domain Coordinates for d1ldkb2:

Click to download the PDB-style file with coordinates for d1ldkb2.
(The format of our PDB-style files is described here.)

Timeline for d1ldkb2: