Class a: All alpha proteins [46456] (171 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81376] (4 PDB entries) |
Domain d1ldkd1: 1ldk D:2084-2140 [73855] Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd2, d1ldke1 complexed with zn |
PDB Entry: 1ldk (more details), 3.1 Å
SCOP Domain Sequences for d1ldkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldkd1 a.157.1.1 (D:2084-2140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
Timeline for d1ldkd1: