Lineage for d1ld8a_ (1ld8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726313Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2726314Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2726315Species Human (Homo sapiens) [TaxId:9606] [69093] (13 PDB entries)
    Uniprot P49354
  8. 2726320Domain d1ld8a_: 1ld8 A: [73838]
    Other proteins in same PDB: d1ld8b_
    complexed with acy, fpp, u49, zn

Details for d1ld8a_

PDB Entry: 1ld8 (more details), 1.8 Å

PDB Description: co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 49
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1ld8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld8a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskh

SCOPe Domain Coordinates for d1ld8a_:

Click to download the PDB-style file with coordinates for d1ld8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ld8a_: