Lineage for d1lb1f_ (1lb1 F:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988400Protein RhoA [52612] (1 species)
  7. 988401Species Human (Homo sapiens) [TaxId:9606] [52613] (19 PDB entries)
    Uniprot P61586 2-181
  8. 988423Domain d1lb1f_: 1lb1 F: [73792]
    Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2

Details for d1lb1f_

PDB Entry: 1lb1 (more details), 2.81 Å

PDB Description: crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d1lb1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb1f_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d1lb1f_:

Click to download the PDB-style file with coordinates for d1lb1f_.
(The format of our PDB-style files is described here.)

Timeline for d1lb1f_: