SCOPe 2.01: Domain d1lb1c2: 1lb1 C:819-953

Lineage for d1lb1c2 (1lb1 C:819-953)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Dbl's big sister, Dbs [74989] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
   SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence

8. Domain d1lb1c2: 1lb1 C:819-953 [73788]
   Other proteins in same PDB: d1lb1a1, d1lb1b_, d1lb1c1, d1lb1d_, d1lb1e1, d1lb1f_, d1lb1g1, d1lb1h_

Details for d1lb1c2

PDB Entry: 1lb1, 2.81 Å

PDB Description: crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa

PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1lb1c2:

Sequence, based on SEQRES records:

>d1lb1c2 b.55.1.1 (C:819-953) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacr

Sequence, based on observed residues (ATOM records):

>d1lb1c2 b.55.1.1 (C:819-953) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflhekavlfckkreengegye
kapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkv
ltsqlqacr

Timeline for d1lb1c2:

• d1lb1c2 first appeared in SCOP 1.61
  
• d1lb1c2 appears in SCOP 1.75
  
• d1lb1c2 appears in SCOPe 2.02
  
• d1lb1c2 appears in the current release, SCOPe 2.08