Lineage for d1l9na1 (1l9n A:1-140)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770734Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 1770735Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 1770753Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (5 PDB entries)
  8. 1770754Domain d1l9na1: 1l9n A:1-140 [73740]
    Other proteins in same PDB: d1l9na2, d1l9na3, d1l9na4, d1l9nb2, d1l9nb3, d1l9nb4
    complexed with bgl, ca, cl

Details for d1l9na1

PDB Entry: 1l9n (more details), 2.1 Å

PDB Description: three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E3

SCOPe Domain Sequences for d1l9na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9na1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1l9na1:

Click to download the PDB-style file with coordinates for d1l9na1.
(The format of our PDB-style files is described here.)

Timeline for d1l9na1: