Lineage for d1l9na1 (1l9n A:1-140)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160881Protein Transglutaminase N-terminal domain [49235] (4 species)
  7. 160897Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (2 PDB entries)
  8. 160898Domain d1l9na1: 1l9n A:1-140 [73740]
    Other proteins in same PDB: d1l9na2, d1l9na3, d1l9na4, d1l9nb2, d1l9nb3, d1l9nb4

Details for d1l9na1

PDB Entry: 1l9n (more details), 2.1 Å

PDB Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation

SCOP Domain Sequences for d1l9na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9na1 b.1.1.5 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1l9na1:

Click to download the PDB-style file with coordinates for d1l9na1.
(The format of our PDB-style files is described here.)

Timeline for d1l9na1: