Class a: All alpha proteins [46456] (202 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein alpha-catenin [47222] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [63511] (2 PDB entries) |
Domain d1l7cc2: 1l7c C:508-631 [73652] CASP4 complexed with mse |
PDB Entry: 1l7c (more details), 2.5 Å
SCOP Domain Sequences for d1l7cc2:
Sequence, based on SEQRES records: (download)
>d1l7cc2 a.24.9.1 (C:508-631) alpha-catenin {Human (Homo sapiens)} iddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgv ytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgirdirk avlm
>d1l7cc2 a.24.9.1 (C:508-631) alpha-catenin {Human (Homo sapiens)} iddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgv ytekvleatkllsntvmprfteqveaavealssdenefidasrlvydgirdirkavlm
Timeline for d1l7cc2:
View in 3D Domains from other chains: (mouse over for more information) d1l7ca1, d1l7ca2, d1l7cb1, d1l7cb2 |