SCOP 1.67: Domain d1l7cc1: 1l7c C:393-507

Lineage for d1l7cc1 (1l7c C:393-507)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein alpha-catenin [47222] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63511] (2 PDB entries)

8. Domain d1l7cc1: 1l7c C:393-507 [73651]

Details for d1l7cc1

PDB Entry: 1l7c, 2.5 Å

PDB Description: alpha-catenin fragment, residues 385-651

SCOP Domain Sequences for d1l7cc1:

Sequence; same for both SEQRES and ATOM records:

>d1l7cc1 a.24.9.1 (C:393-507) alpha-catenin {Human (Homo sapiens)}
sfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegvklvrm
sasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavddits

Timeline for d1l7cc1:

• d1l7cc1 first appeared in SCOP 1.61
  
• d1l7cc1 appears in SCOP 1.65
  
• d1l7cc1 appears in SCOP 1.69
  
• d1l7cc1 appears in the current release, SCOPe 2.08