Lineage for d1l0ya2 (1l0y A:118-244)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290095Protein T-cell antigen receptor [49125] (6 species)
  7. 290139Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)
  8. 290144Domain d1l0ya2: 1l0y A:118-244 [73441]
    Other proteins in same PDB: d1l0ya1, d1l0yb1, d1l0yb2, d1l0yc1, d1l0yd1, d1l0yd2

Details for d1l0ya2

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ya2 b.1.1.2 (A:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

SCOP Domain Coordinates for d1l0ya2:

Click to download the PDB-style file with coordinates for d1l0ya2.
(The format of our PDB-style files is described here.)

Timeline for d1l0ya2: