SCOP 1.65: Domain d1kz7d_: 1kz7 D:

Lineage for d1kz7d_ (1kz7 D:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)

8. Domain d1kz7d_: 1kz7 D: [73338]
   Other proteins in same PDB: d1kz7a1, d1kz7a2, d1kz7c1, d1kz7c2
   complexed with mse; mutant

Details for d1kz7d_

PDB Entry: 1kz7, 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42

SCOP Domain Sequences for d1kz7d_:

Sequence; same for both SEQRES and ATOM records:

>d1kz7d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal

Timeline for d1kz7d_:

• d1kz7d_ first appeared in SCOP 1.61
  
• d1kz7d_ appears in SCOP 1.63
  
• d1kz7d_ appears in SCOP 1.67
  
• d1kz7d_ appears in the current release, SCOPe 2.08