Lineage for d1kyad3 (1kya D:301-499)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114921Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 1114967Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 1115004Species Trametes versicolor, laccase 1 [TaxId:5325] [74871] (1 PDB entry)
  8. 1115016Domain d1kyad3: 1kya D:301-499 [73214]
    complexed with cu, nag, pye, xyd

Details for d1kyad3

PDB Entry: 1kya (more details), 2.4 Å

PDB Description: active laccase from trametes versicolor complexed with 2,5-xylidine
PDB Compounds: (D:) laccase

SCOPe Domain Sequences for d1kyad3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyad3 b.6.1.3 (D:301-499) Laccase {Trametes versicolor, laccase 1 [TaxId: 5325]}
nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
pqawsdlcptydardpsdq

SCOPe Domain Coordinates for d1kyad3:

Click to download the PDB-style file with coordinates for d1kyad3.
(The format of our PDB-style files is described here.)

Timeline for d1kyad3: