![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Laccase [49557] (5 species) consists of three domains of this fold |
![]() | Species Trametes versicolor, laccase 1 [TaxId:5325] [74871] (1 PDB entry) |
![]() | Domain d1kyad1: 1kya D:1-130 [73212] complexed with cu, nag, pye, xyd |
PDB Entry: 1kya (more details), 2.4 Å
SCOPe Domain Sequences for d1kyad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyad1 b.6.1.3 (D:1-130) Laccase {Trametes versicolor, laccase 1 [TaxId: 5325]} gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl rgpfvvydpn
Timeline for d1kyad1: