SCOP 1.63: Domain d1kxvb1: 1kxv B:404-496

Lineage for d1kxvb1 (1kxv B:404-496)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)

8. Domain d1kxvb1: 1kxv B:404-496 [73188]
   Other proteins in same PDB: d1kxva2, d1kxvb2, d1kxvc_, d1kxvd_

Details for d1kxvb1

PDB Entry: 1kxv, 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvb1:

Sequence; same for both SEQRES and ATOM records:

>d1kxvb1 b.71.1.1 (B:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1kxvb1:

• d1kxvb1 first appeared in SCOP 1.61
  
• d1kxvb1 appears in SCOP 1.65
  
• d1kxvb1 appears in the current release, SCOPe 2.08