Class b: All beta proteins [48724] (119 folds) |
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Animal alpha-amylase [51024] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries) |
Domain d1kxvb1: 1kxv B:404-496 [73188] Other proteins in same PDB: d1kxva2, d1kxvb2, d1kxvc_, d1kxvd_ |
PDB Entry: 1kxv (more details), 1.6 Å
SCOP Domain Sequences for d1kxvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxvb1 b.71.1.1 (B:404-496) Animal alpha-amylase {Pig (Sus scrofa)} qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct gikvyvssdgtaqfsisnsaedpfiaihaeskl
Timeline for d1kxvb1:
View in 3D Domains from other chains: (mouse over for more information) d1kxva1, d1kxva2, d1kxvc_, d1kxvd_ |