Lineage for d1kxvc_ (1kxv C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219307Species Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase [74823] (1 PDB entry)
  8. 219308Domain d1kxvc_: 1kxv C: [73190]
    Other proteins in same PDB: d1kxva1, d1kxva2, d1kxvb1, d1kxvb2

Details for d1kxvc_

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxvc_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH CAB10 against alpha-amylase}
vqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyvd
svagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs

SCOP Domain Coordinates for d1kxvc_:

Click to download the PDB-style file with coordinates for d1kxvc_.
(The format of our PDB-style files is described here.)

Timeline for d1kxvc_: