SCOPe 2.02: Domain d1kxjb_: 1kxj B:

Lineage for d1kxjb_ (1kxj B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)

8. Domain d1kxjb_: 1kxj B: [73154]
   complexed with po4

Details for d1kxjb_

PDB Entry: 1kxj, 2.8 Å

PDB Description: the crystal structure of glutamine amidotransferase from thermotoga maritima

PDB Compounds: (B:) amidotransferase hish

SCOPe Domain Sequences for d1kxjb_:

Sequence; same for both SEQRES and ATOM records:

>d1kxjb_ c.23.16.1 (B:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
ghmrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegm
rrlrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrl
phmgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfh
peksskigrkllekviecsls

Timeline for d1kxjb_:

• d1kxjb_ first appeared in SCOP 1.61
  
• d1kxjb_ appears in SCOPe 2.01
  
• d1kxjb_ appears in SCOPe 2.03
  
• d1kxjb_ appears in the current release, SCOPe 2.08, called d1kxjb1