Lineage for d1kxha2 (1kxh A:1-354)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (5 species) 
Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51449] (9 PDB entries) 
Domain d1kxha2: 1kxh A:1-354 [73152]
Other proteins in same PDB: d1kxha1
complexed with acr, ca, cl; mutant
Details for d1kxha2
PDB Entry: 1kxh (more details), 2.3 Å
PDB Description: crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose
SCOP Domain Sequences for d1kxha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxha2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfnaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad
SCOP Domain Coordinates for d1kxha2:
Click to download the PDB-style file with coordinates for d1kxha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kxha2:
- d1kxha2 first appeared in SCOP 1.61
- d1kxha2 appears in SCOP 1.65
- d1kxha2 appears in the current release, SCOPe 2.08
View in 3D
