Lineage for d1kuka_ (1kuk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964140Protein Snake venom metalloprotease [55520] (7 species)
  7. 2964153Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)
  8. 2964156Domain d1kuka_: 1kuk A: [73014]
    complexed with cd

Details for d1kuka_

PDB Entry: 1kuk (more details), 1.45 Å

PDB Description: crystal structure of a taiwan habu venom metalloproteinase complexed with pekw.
PDB Compounds: (A:) metalloproteinase

SCOPe Domain Sequences for d1kuka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuka_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

SCOPe Domain Coordinates for d1kuka_:

Click to download the PDB-style file with coordinates for d1kuka_.
(The format of our PDB-style files is described here.)

Timeline for d1kuka_: