Lineage for d1krha1 (1krh A:106-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793527Protein Benzoate dioxygenase reductase [74959] (1 species)
  7. 2793528Species Acinetobacter sp. [TaxId:472] [74960] (1 PDB entry)
  8. 2793529Domain d1krha1: 1krh A:106-205 [72891]
    Other proteins in same PDB: d1krha2, d1krha3, d1krhb2, d1krhb3
    contains 2Fe-2S cluster in the C-terminal extension
    complexed with fad, fes, so4

Details for d1krha1

PDB Entry: 1krh (more details), 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase
PDB Compounds: (A:) Benzoate 1,2-Dioxygenase Reductase

SCOPe Domain Sequences for d1krha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}
ihhfegtlarvenlsdstitfdiqlddgqpdihflagqyvnvtlpgttetrsysfssqpg
nrltgfvvrnvpqgkmseylsvqakagdkmsftgpfgsfy

SCOPe Domain Coordinates for d1krha1:

Click to download the PDB-style file with coordinates for d1krha1.
(The format of our PDB-style files is described here.)

Timeline for d1krha1: