SCOP 1.71: Domain d1klgd2: 1klg D:122-239

Lineage for d1klgd2 (1klg D:122-239)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)

8. Domain d1klgd2: 1klg D:122-239 [72719]
   Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd1
   mutant

Details for d1klgd2

PDB Entry: 1klg, 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klgd2:

Sequence; same for both SEQRES and ATOM records:

>d1klgd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1klgd2:

• d1klgd2 first appeared in SCOP 1.61
  
• d1klgd2 appears in SCOP 1.69
  
• d1klgd2 appears in SCOP 1.73
  
• d1klgd2 appears in the current release, SCOPe 2.08