Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries) |
Domain d1klgd2: 1klg D:122-239 [72719] Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd1 mutant |
PDB Entry: 1klg (more details), 2.4 Å
SCOP Domain Sequences for d1klgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klgd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1klgd2:
View in 3D Domains from other chains: (mouse over for more information) d1klga1, d1klga2, d1klgb1, d1klgb2 |