Lineage for d1klgd2 (1klg D:122-239)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717890Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 717891Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)
  8. 717898Domain d1klgd2: 1klg D:122-239 [72719]
    Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd1
    mutant

Details for d1klgd2

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (D:) Enterotoxin type C-3

SCOP Domain Sequences for d1klgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klgd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1klgd2:

Click to download the PDB-style file with coordinates for d1klgd2.
(The format of our PDB-style files is described here.)

Timeline for d1klgd2: