Lineage for d1kiuf2 (1kiu F:159-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767464Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767465Species Escherichia coli [TaxId:562] [419301] (4 PDB entries)
  8. 2767485Domain d1kiuf2: 1kiu F:159-279 [72534]
    Other proteins in same PDB: d1kiua1, d1kiua2, d1kiub1, d1kiuc1, d1kiuc2, d1kiud1, d1kiue1, d1kiue2, d1kiuf1, d1kiug1, d1kiug2, d1kiuh1, d1kiui1, d1kiui2, d1kiuj1, d1kiuk1, d1kiuk2, d1kiul1, d1kium1, d1kium2, d1kiun1, d1kiuo1, d1kiuo2, d1kiup1
    complexed with mma; mutant
    missing some secondary structures that made up less than one-third of the common domain

Details for d1kiuf2

PDB Entry: 1kiu (more details), 3 Å

PDB Description: fimh adhesin q133n mutant-fimc chaperone complex with methyl-alpha-d- mannose
PDB Compounds: (F:) FimH PROTEIN

SCOPe Domain Sequences for d1kiuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiuf2 b.2.3.2 (F:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d1kiuf2:

Click to download the PDB-style file with coordinates for d1kiuf2.
(The format of our PDB-style files is described here.)

Timeline for d1kiuf2: