Lineage for d1kg0a1 (1kg0 A:82-182)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548801Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 548809Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 548835Domain d1kg0a1: 1kg0 A:82-182 [72441]
    Other proteins in same PDB: d1kg0a2, d1kg0b1, d1kg0b2, d1kg0c_

Details for d1kg0a1

PDB Entry: 1kg0 (more details), 2.65 Å

PDB Description: structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1

SCOP Domain Sequences for d1kg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kg0a1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1kg0a1:

Click to download the PDB-style file with coordinates for d1kg0a1.
(The format of our PDB-style files is described here.)

Timeline for d1kg0a1: