Lineage for d1kfym3 (1kfy M:226-357)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607180Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2607181Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2607182Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2607221Protein Fumarate reductase [56429] (2 species)
  7. 2607222Species Escherichia coli [TaxId:562] [56430] (5 PDB entries)
  8. 2607228Domain d1kfym3: 1kfy M:226-357 [72436]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfyb1, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfyn1, d1kfyn2, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, oaa, sf4

Details for d1kfym3

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (M:) fumarate reductase flavoprotein

SCOPe Domain Sequences for d1kfym3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfym3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOPe Domain Coordinates for d1kfym3:

Click to download the PDB-style file with coordinates for d1kfym3.
(The format of our PDB-style files is described here.)

Timeline for d1kfym3: