Lineage for d1kfym3 (1kfy M:226-357)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198685Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 198686Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 198687Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 198716Protein Fumarate reductase flavoprotein subunit [56429] (2 species)
  7. 198717Species Escherichia coli [TaxId:562] [56430] (3 PDB entries)
  8. 198723Domain d1kfym3: 1kfy M:226-357 [72436]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfyb1, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfyn1, d1kfyn2, d1kfyo_, d1kfyp_

Details for d1kfym3

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfym3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfym3 d.168.1.1 (M:226-357) Fumarate reductase flavoprotein subunit {Escherichia coli}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOP Domain Coordinates for d1kfym3:

Click to download the PDB-style file with coordinates for d1kfym3.
(The format of our PDB-style files is described here.)

Timeline for d1kfym3: