SCOPe 2.07: Domain d1kfyb1: 1kfy B:106-243

Lineage for d1kfyb1 (1kfy B:106-243)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Fumarate reductase [46550] (3 species)

7. Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)

8. Domain d1kfyb1: 1kfy B:106-243 [72430]
   Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn2, d1kfyo_, d1kfyp_
   complexed with brs, ce1, f3s, fad, fes, oaa, sf4

Details for d1kfyb1

PDB Entry: 1kfy, 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1kfyb1:

Sequence; same for both SEQRES and ATOM records:

>d1kfyb1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d1kfyb1:

• d1kfyb1 first appeared in SCOP 1.61
  
• d1kfyb1 appears in SCOPe 2.06
  
• d1kfyb1 appears in the current release, SCOPe 2.08