Lineage for d1kfyb1 (1kfy B:106-243)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 149177Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 149178Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 149179Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 149180Species Escherichia coli [TaxId:562] [46551] (3 PDB entries)
  8. 149185Domain d1kfyb1: 1kfy B:106-243 [72430]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn2, d1kfyo_, d1kfyp_

Details for d1kfyb1

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol

SCOP Domain Sequences for d1kfyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyb1 a.1.2.1 (B:106-243) Fumarate reductase iron-sulfur protein, C-terminal domain {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1kfyb1:

Click to download the PDB-style file with coordinates for d1kfyb1.
(The format of our PDB-style files is described here.)

Timeline for d1kfyb1: