Lineage for d1kcvh1 (1kcv H:1-116)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104233Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 1104239Domain d1kcvh1: 1kcv H:1-116 [72315]
    Other proteins in same PDB: d1kcvh2, d1kcvl1, d1kcvl2
    part of anti-hepatitis B Fab pc282

Details for d1kcvh1

PDB Entry: 1kcv (more details), 1.8 Å

PDB Description: Crystal structure of antibody pc282
PDB Compounds: (H:) pc282 immunoglobulin

SCOPe Domain Sequences for d1kcvh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcvh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
qvtlsqsgpglvkpsqslsltctvtsysitsdyawnwirqfagqslewmgyisysgstsy
npslksrisitrdtsknqfflqlnsvttddtatyycarggtgfpywgtgtnvtvsa

SCOPe Domain Coordinates for d1kcvh1:

Click to download the PDB-style file with coordinates for d1kcvh1.
(The format of our PDB-style files is described here.)

Timeline for d1kcvh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcvh2