Lineage for d1k9my_ (1k9m Y:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720856Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 720857Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 720858Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 720859Protein Ribosomal protein L31e [54577] (1 species)
  7. 720860Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
  8. 720874Domain d1k9my_: 1k9m Y: [72236]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9my_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Y:) ribosomal protein l31e

SCOP Domain Sequences for d1k9my_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9my_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1k9my_:

Click to download the PDB-style file with coordinates for d1k9my_.
(The format of our PDB-style files is described here.)

Timeline for d1k9my_: