Lineage for d1k9mk_ (1k9m K:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691478Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 691479Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 691480Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 691481Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 691482Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
  8. 691496Domain d1k9mk_: 1k9m K: [72222]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mk_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (K:) ribosomal protein l13

SCOP Domain Sequences for d1k9mk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mk_ c.21.1.1 (K:) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1k9mk_:

Click to download the PDB-style file with coordinates for d1k9mk_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mk_: