Lineage for d1k9mx_ (1k9m X:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726215Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 726216Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 726217Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 726218Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 726219Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
  8. 726233Domain d1k9mx_: 1k9m X: [72235]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mx_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (X:) ribosomal protein l30

SCOP Domain Sequences for d1k9mx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mx_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1k9mx_:

Click to download the PDB-style file with coordinates for d1k9mx_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mx_: