| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
| Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries) |
| Domain d1ji2a3: 1ji2 A:121-502 [71674] Other proteins in same PDB: d1ji2a1, d1ji2a2, d1ji2b1, d1ji2b2 complexed with ca has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ji2 (more details), 2.3 Å
SCOPe Domain Sequences for d1ji2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji2a3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr
Timeline for d1ji2a3: