Lineage for d1j5ya2 (1j5y A:68-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207038Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2207149Superfamily d.94.2: Putative transcriptional regulator TM1602, C-terminal domain [75500] (1 family) (S)
    automatically mapped to Pfam PF02829
  5. 2207150Family d.94.2.1: Putative transcriptional regulator TM1602, C-terminal domain [75501] (1 protein)
  6. 2207151Protein Putative transcriptional regulator TM1602, C-terminal domain [75502] (1 species)
  7. 2207152Species Thermotoga maritima [TaxId:2336] [75503] (1 PDB entry)
  8. 2207153Domain d1j5ya2: 1j5y A:68-174 [71593]
    Other proteins in same PDB: d1j5ya1
    structural genomics
    complexed with k, ni

Details for d1j5ya2

PDB Entry: 1j5y (more details), 2.3 Å

PDB Description: crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution
PDB Compounds: (A:) transcriptional regulator, biotin repressor family

SCOPe Domain Sequences for d1j5ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ya2 d.94.2.1 (A:68-174) Putative transcriptional regulator TM1602, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ksgvsrlvavkhapeeikeellcvvrnggrivdvivehpvygeirgiidvsseeevlkfv
nlmemakteplltlsggvhlhtieapdeetmerimrelkkkgfliee

SCOPe Domain Coordinates for d1j5ya2:

Click to download the PDB-style file with coordinates for d1j5ya2.
(The format of our PDB-style files is described here.)

Timeline for d1j5ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j5ya1