Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.1: Biotin repressor-like [46786] (2 proteins) automatically mapped to Pfam PF08279 |
Protein Putative transcriptional regulator TM1602, N-terminal domain [74674] (1 species) |
Species Thermotoga maritima [TaxId:2336] [74675] (1 PDB entry) |
Domain d1j5ya1: 1j5y A:3-67 [71592] Other proteins in same PDB: d1j5ya2 structural genomics complexed with k, ni |
PDB Entry: 1j5y (more details), 2.3 Å
SCOPe Domain Sequences for d1j5ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mktvrqerlksivrilerskepvsgaqlaeelsvsrqvivqdiaylrslgynivatprgy vlagg
Timeline for d1j5ya1: