Lineage for d1j5ua1 (1j5u A:7-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006421Fold d.208: MTH1598-like [69818] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta(4); 3 layers: beta/alpha/beta; some similarity to the Hsp33 fold
  4. 3006422Superfamily d.208.1: MTH1598-like [69819] (1 family) (S)
    automatically mapped to Pfam PF01951
  5. 3006423Family d.208.1.1: MTH1598-like [69820] (2 proteins)
  6. 3006427Protein Hypothetical protein TM1083 [75550] (1 species)
  7. 3006428Species Thermotoga maritima [TaxId:2336] [75551] (1 PDB entry)
  8. 3006429Domain d1j5ua1: 1j5u A:7-130 [71584]
    Other proteins in same PDB: d1j5ua2
    structural genomics
    complexed with ca

Details for d1j5ua1

PDB Entry: 1j5u (more details), 2 Å

PDB Description: crystal structure of an archease, possible chaperone (tm1083) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (A:) archease, possible chaperone

SCOPe Domain Sequences for d1j5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ua1 d.208.1.1 (A:7-130) Hypothetical protein TM1083 {Thermotoga maritima [TaxId: 2336]}
mrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmypleetedaffdt
vndwileiskgwapwrikregnelkvtfrkirkkegteikaltyhllkferdgdvlktkv
vfdt

SCOPe Domain Coordinates for d1j5ua1:

Click to download the PDB-style file with coordinates for d1j5ua1.
(The format of our PDB-style files is described here.)

Timeline for d1j5ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j5ua2