SCOPe 2.07: Domain d1j5ua1: 1j5u A:7-130

Lineage for d1j5ua1 (1j5u A:7-130)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.208: MTH1598-like [69818] (1 superfamily)
   beta(2)-alpha-beta-alpha-beta(4); 3 layers: beta/alpha/beta; some similarity to the Hsp33 fold

4. Superfamily d.208.1: MTH1598-like [69819] (1 family)
   automatically mapped to Pfam PF01951

5. Family d.208.1.1: MTH1598-like [69820] (2 proteins)

6. Protein Hypothetical protein TM1083 [75550] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75551] (1 PDB entry)

8. Domain d1j5ua1: 1j5u A:7-130 [71584]
   Other proteins in same PDB: d1j5ua2
   structural genomics
   complexed with ca

Details for d1j5ua1

PDB Entry: 1j5u, 2 Å

PDB Description: crystal structure of an archease, possible chaperone (tm1083) from thermotoga maritima at 2.0 a resolution

PDB Compounds: (A:) archease, possible chaperone

SCOPe Domain Sequences for d1j5ua1:

Sequence; same for both SEQRES and ATOM records:

>d1j5ua1 d.208.1.1 (A:7-130) Hypothetical protein TM1083 {Thermotoga maritima [TaxId: 2336]}
mrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmypleetedaffdt
vndwileiskgwapwrikregnelkvtfrkirkkegteikaltyhllkferdgdvlktkv
vfdt

Timeline for d1j5ua1:

• d1j5ua1 first appeared in SCOP 1.61, called d1j5ua_
  
• d1j5ua1 appears in SCOPe 2.06
  
• d1j5ua1 appears in the current release, SCOPe 2.08