Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species) |
Species South China Sea lobster (Palinurus versicolor) [TaxId:82835] [51811] (5 PDB entries) |
Domain d1ihxb1: 1ihx B:1-148,B:313-334 [71213] Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2 |
PDB Entry: 1ihx (more details), 2.8 Å
SCOP Domain Sequences for d1ihxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihxb1 c.2.1.3 (B:1-148,B:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 82835]} skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa
Timeline for d1ihxb1: