SCOP 1.73: Domain d1ihxd1: 1ihx D:1-148,D:313-334

Lineage for d1ihxd1 (1ihx D:1-148,D:313-334)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species South China Sea lobster (Palinurus versicolor) [TaxId:82835] [51811] (5 PDB entries)

8. Domain d1ihxd1: 1ihx D:1-148,D:313-334 [71217]
   Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2
   complexed with snd, so4

Details for d1ihxd1

PDB Entry: 1ihx, 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry

PDB Compounds: (D:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1ihxd1:

Sequence; same for both SEQRES and ATOM records:

>d1ihxd1 c.2.1.3 (D:1-148,D:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 82835]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

Timeline for d1ihxd1:

• d1ihxd1 first appeared in SCOP 1.61
  
• d1ihxd1 appears in SCOP 1.71
  
• d1ihxd1 appears in SCOP 1.75
  
• d1ihxd1 appears in the current release, SCOPe 2.08