SCOP 1.75: Domain d1ihxb1: 1ihx B:1-148,B:313-334

Lineage for d1ihxb1 (1ihx B:1-148,B:313-334)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)

8. Domain d1ihxb1: 1ihx B:1-148,B:313-334 [71213]
   Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2

Details for d1ihxb1

PDB Entry: 1ihx, 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry

PDB Compounds: (B:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1ihxb1:

Sequence; same for both SEQRES and ATOM records:

>d1ihxb1 c.2.1.3 (B:1-148,B:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

Timeline for d1ihxb1:

• d1ihxb1 first appeared in SCOP 1.61
  
• d1ihxb1 appears in SCOP 1.73
  
• d1ihxb1 appears in SCOPe 2.01
  
• d1ihxb1 appears in the current release, SCOPe 2.08