Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.4: T-box [81316] (3 proteins) automatically mapped to Pfam PF00907 |
Protein T-box protein 3, tbx3 [74868] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74869] (1 PDB entry) |
Domain d1h6fb_: 1h6f B: [70902] complexed with mg |
PDB Entry: 1h6f (more details), 1.7 Å
SCOPe Domain Sequences for d1h6fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6fb_ b.2.5.4 (B:) T-box protein 3, tbx3 {Human (Homo sapiens) [TaxId: 9606]} kddpkvhleakelwdqfhkrgtemvitksgrrmfppfkvrcsgldkkakyillmdiiaad dcrykfhnsrwmvagkadpempkrmyihpdspatgeqwmskvvtfhklkltnnisdkhgf tilnsmhkyqprfhivrandilklpystfrtylfpetefiavtayqndkitqlkidnnpf akgfrd
Timeline for d1h6fb_: