Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (7 species) |
Species Anabaena sp. [TaxId:1167] [75409] (1 PDB entry) |
Domain d1gv3b2: 1gv3 B:127-237 [70588] Other proteins in same PDB: d1gv3a1, d1gv3b1 complexed with mn |
PDB Entry: 1gv3 (more details), 2 Å
SCOPe Domain Sequences for d1gv3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gv3b2 d.44.1.1 (B:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} dgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqd npimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqas
Timeline for d1gv3b2: