SCOP 1.61: Domain d1gv3b2: 1gv3 B:127-237

Lineage for d1gv3b2 (1gv3 B:127-237)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Anabaena sp. [75409] (1 PDB entry)

8. Domain d1gv3b2: 1gv3 B:127-237 [70588]
   Other proteins in same PDB: d1gv3a1, d1gv3b1

Details for d1gv3b2

PDB Entry: 1gv3, 2 Å

PDB Description: the 2.0 angstrom resolution structure of the catalytic portion of a cyanobacterial membrane-bound manganese superoxide dismutase

SCOP Domain Sequences for d1gv3b2:

Sequence; same for both SEQRES and ATOM records:

>d1gv3b2 d.44.1.1 (B:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp.}
dgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqd
npimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqas

Timeline for d1gv3b2:

• d1gv3b2 is new in SCOP 1.61
  
• d1gv3b2 appears in SCOP 1.63
  
• d1gv3b2 appears in the current release, SCOPe 2.08