Lineage for d1gthd5 (1gth D:845-1020)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026489Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1026616Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1026631Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 1026632Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 1026648Domain d1gthd5: 1gth D:845-1020 [70502]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha4, d1gthb1, d1gthb2, d1gthb3, d1gthb4, d1gthc1, d1gthc2, d1gthc3, d1gthc4, d1gthd1, d1gthd2, d1gthd3, d1gthd4
    complexed with fad, fmn, idh, iur, ndp, sf4, ura

Details for d1gthd5

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gthd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gthd5 d.58.1.5 (D:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

SCOPe Domain Coordinates for d1gthd5:

Click to download the PDB-style file with coordinates for d1gthd5.
(The format of our PDB-style files is described here.)

Timeline for d1gthd5: