Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries) |
Domain d1gthc3: 1gth C:288-440 [70495] Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha4, d1gtha5, d1gthb1, d1gthb2, d1gthb4, d1gthb5, d1gthc1, d1gthc2, d1gthc4, d1gthc5, d1gthd1, d1gthd2, d1gthd4, d1gthd5 complexed with fad, fmn, idh, iur, ndp, sf4, ura |
PDB Entry: 1gth (more details), 2.25 Å
SCOPe Domain Sequences for d1gthc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gthc3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq fvrteqdetgkwnededqivhlkadvvisafgs
Timeline for d1gthc3:
View in 3D Domains from same chain: (mouse over for more information) d1gthc1, d1gthc2, d1gthc4, d1gthc5 |