Lineage for d1k9ig_ (1k9i G:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139437Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 139438Species Human (Homo sapiens) [TaxId:9606] [69856] (1 PDB entry)
  8. 139445Domain d1k9ig_: 1k9i G: [68349]

Details for d1k9ig_

PDB Entry: 1k9i (more details), 2.5 Å

PDB Description: complex of dc-sign and glcnac2man3

SCOP Domain Sequences for d1k9ig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ig_ d.169.1.1 (G:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens)}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

SCOP Domain Coordinates for d1k9ig_:

Click to download the PDB-style file with coordinates for d1k9ig_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ig_: